PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000492089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LFY
Protein Properties Length: 406aa    MW: 45168.6 Da    PI: 7.7799
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000492089genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY595.21.4e-1811739021386
        FLO_LFY  21 apparlleeaavseapleaaaaaaarklr........eleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryG 108
                     p++r+  eaav++a+ +aa aaa ++lr        +le+lf+ayGvry+t+akiaelGftv+tL+d+kd+eldd+m+sls+ifr++llvGeryG
  MDP0000492089  17 VPTNRVHLEAAVPPAA-TAAGAAAGYTLRpprelglgGLEDLFQAYGVRYYTAAKIAELGFTVNTLLDLKDDELDDMMSSLSQIFRWELLVGERYG 111
                    5667777777666655.66666777777778888888*********************************************************** PP

        FLO_LFY 109 ikaavraerrrleeeeaekkrrkllsedeet.aldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelks 203
                    ikaavraerrr+eee+  ++rr+ +s d++t aldalsqeglseepvq+eke++g+g ++  ++e+v+a +++++++++k+ + ++      +   
  MDP0000492089 112 IKAAVRAERRRFEEED--SRRRNPVSGDTTTnALDALSQEGLSEEPVQQEKEMVGTGVGM--AWEVVTAGQRRKKQRRMKKGQYRNCSAGGGH--- 200
                    **************88..77777898887766********************99998887..9999999875554444444333322222111... PP

        FLO_LFY 204 e......ededeeeeed.edeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakka 292
                    +       d+++++ ++ +   +  e+g erqre PfivtepgevargkknGLDYLf Lye Cr+fL+qvq+iakerGekcPtkvtnqvfryakk+
  MDP0000492089 201 DndhnegVDDKDDDMDNmNGAGERVEEGGERQREXPFIVTEPGEVARGKKNGLDYLFYLYELCRDFLIQVQNIAKERGEKCPTKVTNQVFRYAKKS 296
                    11222333333333333033344667889******************************************************************* PP

        FLO_LFY 293 gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                    gasyinkPkmrhYvhCYalhcLd easn lrrafkergenvGawrqacykplv iaa qgwdida+fn+hprLsiWYvPtkLrqLCh+er++a+
  MDP0000492089 297 GASYINKPKMRHYVHCYALHCLDVEASNVLRRAFKERGENVGAWRQACYKPLVVIAAAQGWDIDAIFNSHPRLSIWYVPTKLRQLCHAERHNAT 390
                    ******************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.4E-18528389IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MPSLRTCSSG TLRGMVVPTN RVHLEAAVPP AATAAGAAAG YTLRPPRELG LGGLEDLFQA  60
YGVRYYTAAK IAELGFTVNT LLDLKDDELD DMMSSLSQIF RWELLVGERY GIKAAVRAER  120
RRFEEEDSRR RNPVSGDTTT NALDALSQEG LSEEPVQQEK EMVGTGVGMA WEVVTAGQRR  180
KKQRRMKKGQ YRNCSAGGGH DNDHNEGVDD KDDDMDNMNG AGERVEEGGE RQREXPFIVT  240
EPGEVARGKK NGLDYLFYLY ELCRDFLIQV QNIAKERGEK CPTKVTNQVF RYAKKSGASY  300
INKPKMRHYV HCYALHCLDV EASNVLRRAF KERGENVGAW RQACYKPLVV IAAAQGWDID  360
AIFNSHPRLS IWYVPTKLRQ LCHAERHNAT ASSSASGGGG EHLPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1052284002186PROTEIN LEAFY
2vy2_A1e-1052284002186PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177184QRRKKQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1620280.0AB162028.1 Malus x domestica AFL1 mRNA for LEAFY protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280945.10.0floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLQ5KTE20.0Q5KTE2_CYDOB; LEAFY protein
STRINGVIT_17s0000g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-125floral meristem identity control protein LEAFY (LFY)